PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00047.1_g00026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARF
Protein Properties Length: 685aa    MW: 76563.6 Da    PI: 6.2463
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00047.1_g00026.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.74.6e-23111211198
                              EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-E CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDf 79 
                              f+k+lt sd++++g +++ +k+a+e+       + + + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD 
  Sme2.5_00047.1_g00026.1 111 FCKILTASDTSTHGGFSVLRKHATEClppldmtQ-V-TPTQDLVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDA 194
                              99****************************9643.3.34459******************************************** PP

                              EEEEE-SSSEE..EEEEE- CS
                       B3  80 vvFkldgrsefelvvkvfr 98 
                              +vF   + +++el+v+v+r
  Sme2.5_00047.1_g00026.1 195 FVFL--RGDNGELRVGVRR 211
                              ****..3489999****98 PP

2Auxin_resp105.27.8e-35237316183
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                              a+ha++t++ F v+Y+Pra  s+F+v ++k+++a+++ +svGmRf+m+fe+eds+err++Gt+vg+ d+++ +Wp+SkWr+Lk
  Sme2.5_00047.1_g00026.1 237 ASHAITTHTRFAVFYKPRA--SQFIVGLNKYLEAVSHGFSVGMRFRMRFEGEDSPERRFTGTIVGTGDISS-QWPESKWRCLK 316
                              789***************8..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.7E-38103240IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.1E-39105226IPR015300DNA-binding pseudobarrel domain
CDDcd100172.29E-20109211No hitNo description
SMARTSM010191.6E-21111213IPR003340B3 DNA binding domain
PfamPF023625.8E-21111211IPR003340B3 DNA binding domain
PROSITE profilePS5086311.885111213IPR003340B3 DNA binding domain
PfamPF065072.1E-32237316IPR010525Auxin response factor
PfamPF023091.3E-12562660IPR033389AUX/IAA domain
SuperFamilySSF542771.91E-13564646No hitNo description
PROSITE profilePS5174528.03570662IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    Send to blast
MGSEDLYKEL WKACAGPLVD IPRDGERVYY FPQGHIEQLE ASTNQAVNQQ IPQFNLSSKI  60
LCRVDHVQLL AEVETDEVYA QIMLHPEAKQ DEPSEPDPCP PDLPKRAIHS FCKILTASDT  120
STHGGFSVLR KHATECLPPL DMTQVTPTQD LVAKDLHGYE WRFKHIFRGQ PRRHLLTTGW  180
STFVTSKRLV AGDAFVFLRG DNGELRVGVR RLARQQIPMP QSVISSQSMH LGVLATASHA  240
ITTHTRFAVF YKPRASQFIV GLNKYLEAVS HGFSVGMRFR MRFEGEDSPE RRFTGTIVGT  300
GDISSQWPES KWRCLKIQWD EPASILRPEK VSPWEIEPFV ASSSVDVAQP GIKSKRPRPI  360
DLSRSEIVVA SAASPFWCPG SGPTLEVGQL GGITEVQSHD NQLFWSLKQN SSLSNSMNNT  420
SCRTHLSGAW QPSMLTNGSV NLLRDSIEDN KQLITRSTLL DYGSPMSSRL SNGLLHDQVN  480
SSNKREMSSG CRLFGIDLRS NSSNTSTKAK EMLGLNVTSN CADEARVVPD ETEVDKDQDV  540
EHLTPSEEKR QVQLEALPKD THKQGLTSSR TRTKVQMQGV RVGRAVDLTA LSGYDDLISE  600
LEKIFDIKGE LCPRNKWEVV YTDDEGDMML VGDDPWPEFC TMVRRIFIYS SEEVKKMSPR  660
CKLPILSLEG EGTMPSVDSD LNAEG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-168334316359Auxin response factor 1
4ldw_A1e-168334316359Auxin response factor 1
4ldv_A1e-168334316359Auxin response factor 1
4ldx_B1e-168334316359Auxin response factor 1
4ldx_A1e-168334316359Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1354358KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2331200.0AC233120.6 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-101i8 map 1, complete sequence.
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006339723.10.0PREDICTED: auxin response factor 18 isoform X1
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A0V0ISA10.0A0A0V0ISA1_SOLCH; Auxin response factor
STRINGPGSC0003DMT4000003450.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9